Product Details
Research-grade peptides with clear specifications, COA-backed quality verification, and Fahrenheit storage guidance for laboratory use.
LL-37 -5MG
Overview
LL-37 is a 37-amino-acid peptide derived from a human protein called cathelicidin.
$30.00
Out of stock
Share this item
Description
LL-37 is a 37-amino-acid peptide derived from a human protein called cathelicidin. It has broad-spectrum antimicrobial activity, disrupting bacterial membranes, and it can break down biofilms. Beyond fighting infections, it also modulates the immune response, acting both as a pro-inflammatory and anti-inflammatory agent. It promotes tissue repair, angiogenesis, and cell migration, but it’s also linked to conditions like psoriasis and even neurodegeneration, so its effects are complex and still being studied.
LL-37 / Human Cathelicidin Antimicrobial Peptide Research Details
LL-37 is the only human cathelicidin antimicrobial peptide and is heavily studied in innate-immunity literature. Research examines bacterial membrane disruption, biofilm biology, host-cell signaling, wound environments, inflammation, and context-dependent immune effects.
99%+ target purity or lot-specific COA value
LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Lyophilized research material unless otherwise specified by COA
Research use only
Research Background
Cationic amphipathic antimicrobial peptide derived from human cathelicidin hCAP18; studied for membrane interaction, biofilm, chemotaxis, and immune modulation. Key OneBio research contexts include innate-immunity assays, antimicrobial peptide models, biofilm research, epithelial signaling, and wound-environment studies.
Specifications
| Compound | LL-37 / Human Cathelicidin Antimicrobial Peptide |
| SKU / Product | ll37 |
| Molecular Weight | ~4493.3 g/mol |
| Formula / Classification | C205H341N61O52 |
| Database / Identity Note | PubChem CID 16133648 |
| Storage | -4°F long-term; 35-46°F short-term refrigerated; 39°F after reconstitution for up to 30 days when appropriate for the research protocol |
Quality Verification
Each batch should be reviewed against its Certificate of Analysis, including identity confirmation, purity method, mass/sequence or component confirmation, appearance, and lot-specific handling notes. Blend products should be checked against component-ratio documentation where available.
Laboratory Preparation
Prepare only inside a qualified laboratory using validated solvent choice, concentration, sterility, and storage protocols. For lyophilized peptides, use sterile deionized water or bacteriostatic water when appropriate for the research protocol, mix gently, maintain cold-chain handling, and avoid repeated freeze-thaw cycles.
Product-Specific Q&A
What is LL-37 / Human Cathelicidin Antimicrobial Peptide used for in research?
LL-37 / Human Cathelicidin Antimicrobial Peptide is used as a research material for innate-immunity assays, antimicrobial peptide models, biofilm research, epithelial signaling, and wound-environment studies. It is not offered for diagnostic, therapeutic, clinical, veterinary, or human-use applications.
What mechanism is most relevant for LL-37 / Human Cathelicidin Antimicrobial Peptide?
Cationic amphipathic antimicrobial peptide derived from human cathelicidin hCAP18; studied for membrane interaction, biofilm, chemotaxis, and immune modulation.
How should LL-37 / Human Cathelicidin Antimicrobial Peptide identity and purity be verified?
Use the lot-specific Certificate of Analysis to confirm identity, purity, mass/sequence or component profile, and any method-specific data such as LC-MS/HPLC. Technical values on this page are research references and should be checked against the delivered lot.
What storage conditions apply to LL-37 / Human Cathelicidin Antimicrobial Peptide?
-4°F long-term; 35-46°F short-term refrigerated; 39°F after reconstitution for up to 30 days when appropriate for the research protocol. Keep sealed, dry, protected from light, and avoid repeated freeze-thaw cycles after preparation.
References
- PMID 39351216: Signaling pathways and targeted therapy for rosacea. Frontiers in immunology 2024.
- PMID 40063262: Human antimicrobial/host defense peptide LL-37 may prevent the spread of a local infection through multiple mechanisms: an update. Inflammation research : official journal of the European Histamine Research Society … [et al.] 2025.
- PMID 30980360: Design of Antimicrobial Peptides: Progress Made with Human Cathelicidin LL-37. Advances in experimental medicine and biology 2019.
Expanded Product Information
PeptideTech-style product tools added beneath the existing OneBio product layout: tabs, specifications, COA guidance, shipping/storage information, stock-solution guidance, verification notes, and FAQ.
| Product | Current product |
|---|---|
| Form | Lyophilized research material unless otherwise stated on the product label. |
| Purity / Identity | See product listing and available COA/batch documentation. |
| Storage | Long-term freezer storage around -4°F. Short-term refrigerated storage 35–46°F. Reconstituted materials should be handled under validated laboratory protocols. |
| Use Standard | Research-use only; not for human or animal administration. |
Third-party verification: Review the available Certificate of Analysis and batch documentation before use. Verify identity, purity, appearance, and lot-specific details against your lab requirements.
Are these products for research use only?
Yes. OneBio Research products are sold strictly for laboratory research and analytical testing.
Where do I find storage guidance?
Use the product label, COA, and the storage tab above. Long-term freezer storage is commonly referenced around -4°F; refrigerated short-term storage is 35–46°F.
Can I request documentation?
Yes. Use the COA/documentation request link or contact OneBio Research with the product and lot details.
Reviews
There are no reviews yet.