Skip to main content

onebioresearch.com

Product Details

Research-grade peptides with clear specifications, COA-backed quality verification, and Fahrenheit storage guidance for laboratory use.

VIP10 10MG

Rated 4.5 out of 5

Overview

Vasoactive Intestinal Peptide, or VIP, is a 28-amino-acid neuropeptide that acts on two receptors, VPAC1 and VPAC2, triggering pathways like increased cAMP signaling.

$35.00

Out of stock

SKU OBR-VIP-10MG Category

Description

Vasoactive Intestinal Peptide, or VIP, is a 28-amino-acid neuropeptide that acts on two receptors, VPAC1 and VPAC2, triggering pathways like increased cAMP signaling. It functions in many systems: it dilates blood vessels, modulates gut secretion, influences immune responses, and helps regulate circadian rhythms. Though VIP shows promise in animal models for conditions like pulmonary hypertension, inflammation, and metabolism, its very short half-life and broad effects mean it’s still only used in research, not approved as a therapy.

Vasoactive Intestinal Peptide (VIP) Research Details

VIP is a widely studied neuropeptide found in neural, gastrointestinal, pulmonary, endocrine, and immune tissues. It is used in research to examine VPAC receptor pharmacology, cAMP signaling, smooth-muscle/secretory biology, circadian pathways, and immunomodulatory networks.

Purity
99%+ target purity or lot-specific COA value
Sequence / Identity
HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
Form
Lyophilized research material unless otherwise specified by COA
Intended Use
Research use only

Research Background

Endogenous 28-amino-acid neuropeptide acting primarily through VPAC1 and VPAC2 receptors to regulate cAMP-linked signaling. Key OneBio research contexts include vpac receptor studies, camp assays, pulmonary/gastrointestinal signaling models, and neuroimmune research.

Specifications

Compound Vasoactive Intestinal Peptide (VIP)
SKU / Product vip10
Molecular Weight ~3325.8 g/mol
Formula / Classification C147H238N44O42S
Database / Identity Note PubChem CID 16133815
Storage -4°F long-term; 35-46°F short-term refrigerated; 39°F after reconstitution for up to 30 days when appropriate for the research protocol

Quality Verification

Each batch should be reviewed against its Certificate of Analysis, including identity confirmation, purity method, mass/sequence or component confirmation, appearance, and lot-specific handling notes. Blend products should be checked against component-ratio documentation where available.

Laboratory Preparation

Prepare only inside a qualified laboratory using validated solvent choice, concentration, sterility, and storage protocols. For lyophilized peptides, use sterile deionized water or bacteriostatic water when appropriate for the research protocol, mix gently, maintain cold-chain handling, and avoid repeated freeze-thaw cycles.

Product-Specific Q&A

What is Vasoactive Intestinal Peptide (VIP) used for in research?

Vasoactive Intestinal Peptide (VIP) is used as a research material for vpac receptor studies, camp assays, pulmonary/gastrointestinal signaling models, and neuroimmune research. It is not offered for diagnostic, therapeutic, clinical, veterinary, or human-use applications.

What mechanism is most relevant for Vasoactive Intestinal Peptide (VIP)?

Endogenous 28-amino-acid neuropeptide acting primarily through VPAC1 and VPAC2 receptors to regulate cAMP-linked signaling.

How should Vasoactive Intestinal Peptide (VIP) identity and purity be verified?

Use the lot-specific Certificate of Analysis to confirm identity, purity, mass/sequence or component profile, and any method-specific data such as LC-MS/HPLC. Technical values on this page are research references and should be checked against the delivered lot.

What storage conditions apply to Vasoactive Intestinal Peptide (VIP)?

-4°F long-term; 35-46°F short-term refrigerated; 39°F after reconstitution for up to 30 days when appropriate for the research protocol. Keep sealed, dry, protected from light, and avoid repeated freeze-thaw cycles after preparation.

References

Research Use Only: For laboratory research and analytical testing only. Not for human or animal consumption, therapeutic use, diagnostic use, food, drugs, or cosmetics.

Reviews

There are no reviews yet.

Be the first to review “VIP10 10MG”

Your email address will not be published. Required fields are marked *

Research-use product detail system

Expanded Product Information

PeptideTech-style product tools added beneath the existing OneBio product layout: tabs, specifications, COA guidance, shipping/storage information, stock-solution guidance, verification notes, and FAQ.

Intended UseFor laboratory research, analytical testing, and in-vitro research only.
DocumentationBatch documentation and verification details are provided where available.
HandlingUse qualified laboratory practices and proper PPE.
Research Use Only: Not for human consumption, clinical use, therapeutic use, veterinary use, or diagnostic use.
ProductCurrent product
FormLyophilized research material unless otherwise stated on the product label.
Purity / IdentitySee product listing and available COA/batch documentation.
StorageLong-term freezer storage around -4°F. Short-term refrigerated storage 35–46°F. Reconstituted materials should be handled under validated laboratory protocols.
Use StandardResearch-use only; not for human or animal administration.

Third-party verification: Review the available Certificate of Analysis and batch documentation before use. Verify identity, purity, appearance, and lot-specific details against your lab requirements.

ProcessingOrders are processed according to product availability and fulfillment status.
StorageKeep sealed, dry, and protected from heat/light. Use Fahrenheit handling guidance.
Stock SolutionPrepare only inside a qualified laboratory using validated solvent, concentration, and sterility protocols.
Are these products for research use only?

Yes. OneBio Research products are sold strictly for laboratory research and analytical testing.

Where do I find storage guidance?

Use the product label, COA, and the storage tab above. Long-term freezer storage is commonly referenced around -4°F; refrigerated short-term storage is 35–46°F.

Can I request documentation?

Yes. Use the COA/documentation request link or contact OneBio Research with the product and lot details.